SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA24324 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA24324
Domain Number 1 Region: 2-299
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.06e-43
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA24324   Protein: JA20136   Gene: WBGene00179896
Sequence length 395
Comment JA20136 WBGene00179896 status:Predicted
Sequence
MFEYCIVGGGIVGLATALAITRSEPDARILLLEKELSLASHQTGHNSGVIHAGIYYQPGS
LKAELCRVGERATKQFCDTHDIPYRTPGKLVVATNDMELQRLNGLEANATANKISCRMIN
QSELIEMEPAVTGLKALLVEQSGIVDYRAVSSAMGELIKARGATIILGTDVSFVEERSDC
IRVHTNKGVWESRYIVACAGLQSDRLAQRSGLEIDFQIVPFRGEYYALKPELNNLVERMI
YPVPDPSMPFLGIHLTPMMDGSLTVGPNAVLGLSREGYAKFSASLNDIMTYTRFPGFWKV
ISQNLRSGIEEVKDSFFKPSYLDKCRKYCPTLQANDLLPYRAGIRAQAVSNSGHLIHDFK
FLQTKRSLHVCNAPSPAATSAIPIGELIFKRLKTA
Download sequence
Identical sequences 281687.CJA24324 CJA24324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]