SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA24331 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA24331
Domain Number 1 Region: 4-350
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.4e-80
Family FAD-linked reductases, N-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA24331   Protein: JA20181   Gene: WBGene00179903
Sequence length 363
Comment JA20181 WBGene00179903 status:Predicted
Sequence
MAATKTFDYIIIGAGSAGCVLANRLSANPANKVLLLEAGGQDLNPLFRLPMLMGKLFHSG
IYNWHYHTEPEPHLNDRSLYWPRGKVLGGTSTINGMIYVRGNRHDYDRWAQMGATGWSYD
EVLPAFLRSETHVQREDDFHSTKGELTVCRARGWNGLLDVFNEAGEQAGHPLNDDFNGGE
QEGFGRYDFTITKGKRCSAAYAFLRPAKKRPNLTIITRAHTRRVLIENGRAIGVEYSRKG
NVTKVHANREVILSAGVVNSPQILMLSGIGAADELAEHNIKVVRDLPGVGKNLQDHVDCV
MAYECREPVTLYSDLRADKLTLSVIQGMLFGEGITTTFPYEAGAFVKSRADLAAPDIQLH
FMP
Download sequence
Identical sequences CJA24331 281687.CJA24331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]