SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA24412 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA24412
Domain Number 1 Region: 397-693
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.53e-42
Family LacY-like proton/sugar symporter 0.019
Further Details:      
 
Domain Number 2 Region: 1-73,163-244
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.49e-39
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Weak hits

Sequence:  CJA24412
Domain Number - Region: 273-367
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000204
Family Glutathione peroxidase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA24412   Protein: JA36850   Gene: WBGene00179984
Sequence length 696
Comment JA36850 WBGene00179984 status:Predicted
Sequence
MIPQFLTETILRERLAEMGHKVEFGLELSRFEQSTDGVVARVGGANGEKSLQARFLVGAD
GGRSFVRGALGINFPGKTLGARAVVADVMLTGLSRDAWHQFNHGDIEKMVHVCPLAGTDL
FQIQAPISSEGDFDLSAGSLQRLLNERTCQQNIQVRSVKWASAYTMNARLADRYRIGRVF
LVGDAAHIHPPTGGQGLNTSVQDAYNLGWKLAAVLDGASDHLLDSYEEERRPVAKAVLGL
SGRLLNDQKQGEMRRGREVHQLDIGYSGSSLSSENRSQGEALCAGDRAPDAPCKGAAGQP
TRLFQLMQGPHWTLLIHGTEPEDVTPRAGLRIHHVGTDGDVIDQWGYIREAYALQAGECV
LIRPDGLSGKSGPCLLRGNPKMSAEKGVEGDLIPRDKLEWRLMLPLACIIILYAAGVGAV
LPVLPFYLREMGASPLIFGLVLSTEALSQSAASPMLGQLSDRFGRKQVLMASQAVAILSL
LVLALAQNIFTVLLARFLFGFTSGNFSAAAAYAADNSSVATRRQAIGIVSASLGLGAILG
AGLSSMLVEISLLVPIYMALGLALSGLIVTSVFIKKGKVAKQNVALRNRQQISLRAITDS
PVMRVLIIVMLCHFFAYGMYVSQLPNFLAEKFVWNGHALGPREFSYLIAADGMINILVQL
FLLGWLGRSLNERQLIVLIFGLIGTGVIAAGLASTI
Download sequence
Identical sequences CJA24412 281687.CJA24412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]