SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA24495 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA24495
Domain Number 1 Region: 8-124
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000265
Family FAD-linked reductases, N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA24495   Protein: JA35956   Gene: WBGene00180067
Sequence length 124
Comment JA35956 WBGene00180067 status:Predicted
Sequence
MAEFPKKAKVVIVGLGGIVGASVVHHLIERGWDDIVGIDKSGIPTDIGSTAHASDFCYAT
SHDFLSCWTTLYSIDFYEKMGHYARVGGIEVARVGDDSRMDELKRKVASGKAFGTRARLM
EPSE
Download sequence
Identical sequences 281687.CJA24495 CJA24495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]