SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA24506 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA24506
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.3e-41
Family GMC oxidoreductases 0.0064
Further Details:      
 
Domain Number 2 Region: 134-194
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.61e-20
Family FAD-linked reductases, N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA24506   Protein: JA33498   Gene: WBGene00180078
Sequence length 195
Comment JA33498 WBGene00180078 status:Predicted
Sequence
MAPSQLGIFAKSDTSLDTPDLEYHVQPLSTDRLGEPLHRYPAVTVSVCNLRPESRGSVHI
AGPDIELSPHIRPNYLSTPGDKLVAAKSIRHARNLMATRTLAKYQPFEMLPGIQHQSDDE
LVQRAGDIATTIFHPVGTCKMGSDTNSVVDDNLRVRGIEGLRVVDASIMPKIVSGNTNSP
VIMIAEKAADIILNR
Download sequence
Identical sequences 281687.CJA24506 CJA24506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]