SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA25025 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA25025
Domain Number 1 Region: 7-307
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.37e-36
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA25025   Protein: JA36761   Gene: WBGene00180597
Sequence length 504
Comment JA36761 WBGene00180597 status:Predicted
Sequence
HEMAEPETCDLFVIGGGINGAGVARDAAGRGLKVVLAEKDDLAEGTSSRSGKLVHGGLRY
LEYYEFRLVREALIEREVLLNAAPHIIWPMRFVLPHSPQDRPAWLVRLGLFLYDHLGGRK
KLPGTRTLDLKRDPEGTPILDQYTKGFEYSDCWVDDARLVVLNAVGAAEKGATILTRTPV
TSARREKGGWIVETKNRDTGEMRSFRARCIVNCAGPWVTDVITNVAGSNSSRNVRLVKGS
HIIVPKFWSGANAYLVQNHDKRVIFINPYEGDKALIGTTDIAYEGRAEDVSADEKEIDYL
LTAVNRYFKEKLRREDVLHSFSGVRPLFDDGKGNPSAVTRDYVFDLDETSDAPLLNVFGG
KITTFRELAERGMHRLKHIFPSMGGDWTHDAPLPGGEIANADFETFANSLRDSYPWMPRK
LALHYGRLYGARTKDVVAGASDLNGLGQHFGGNLYEAEVRYLVSKEWVKTANDILYRRTK
HYLHLTEAERAAFIAWFDNAKVSA
Download sequence
Identical sequences 281687.CJA25025 CJA25025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]