SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA25294 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA25294
Domain Number 1 Region: 1-296
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.61e-45
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA25294   Protein: JA23393   Gene: WBGene00180866
Sequence length 395
Comment JA23393 WBGene00180866 status:Predicted
Sequence
MYDYCLVGGGIVGLATALTIVRQEPSARILVLEKEEAVAMHQTGHNSGVIHAGIYYQPGS
FKAELCRAGERMTKQFCDENNIAYRVPGKLVVATNEVEVQRLAALETNAAANGITCRRLN
GGELHEFEPAVTGLGALLVEQSGIVDYRAVCRAMADLIRAAGGDIEFNVCVDRIEERSDS
VRVHAGGKVWESMQVIACAGLQADRLARRSGVDVDFQIVPFRGEYYALRPELNKLVERMI
YPVPDPSMPFLGIHLTPMIDGSLTVGPNAVLGLSREGYPKFSANLRDMATYAAFPGFWKV
ITAHLSSGLEEMKDSLFKKSYLEKCRKYCPSLQESDLRPYRAGIRAQAVSRYGKLIHDFK
FHQTKRVLHVCNAPSPAATSAIPIGNLIFQRLQTR
Download sequence
Identical sequences CJA25294 281687.CJA25294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]