SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA25782 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA25782
Domain Number 1 Region: 33-258,348-421
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.83e-48
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA25782   Protein: JA30215   Gene: WBGene00181354
Sequence length 428
Comment JA30215 WBGene00181354 status:Predicted
Sequence
MSYQSPISPGFSWYEASVSERPQYPELDGARQADVVVIGGGYTGLSAAYHLAKQGADVVL
IEAARFGDGASGRNGGQFGTGQRTWAEDLEKQYGFERAKALFNIAEEAKAHLLGFAREHN
IDMEYVPGQISAVHKPRYLKHYQEHAELMATRFNYPHVRYVEREEMATLLGSSRYHGGLY
DAGTGHIHPLKLLIGLARVAAEAGAHIFENTRATKISTVSGRIEVETPRGTISAKNAFLA
VNAHGGDLEPVSAAHVMPIRSFIGATAPLGDDSPVIPGGESVDDSRFVVRYFRKSKDGRL
LFGGREAYTADNPRDISEHIRRQIAEIYPALDKVEITQAWGGSVGITMPRQPFVREVMPG
VISAGGYSGHGVMLANYMGRLYAEVISGKRESLRLFEELRIPAFPGGRTFRAPLLFVALS
WYALMDRI
Download sequence
Identical sequences WP_024896410.1.22424 CJA25782 281687.CJA25782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]