SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA25972 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA25972
Domain Number 1 Region: 92-182
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 9.55e-21
Family KorB DNA-binding domain-like 0.0028
Further Details:      
 
Weak hits

Sequence:  CJA25972
Domain Number - Region: 15-57
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.00011
Family ParB-like nuclease domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA25972   Protein: JA27108   Gene: WBGene00181544
Sequence length 193
Comment JA27108 WBGene00181544 status:Predicted
Sequence
MAQANQKISLNTGREIPFNKLVLSQQNVRKTEAGVSIEELADDIANRGLLTSLNVRAELD
ADGKETASIAFQQADAVTALWNYCSGETLEVEDSLAENFNRVELHPLDEFRAILDLREQG
LDEEEIAARFHMSVATVKQRLRLASVSSRLLELYANDEMKVGQIMAFSITNDHARQELAA
PEGPARRSAVRAA
Download sequence
Identical sequences 281687.CJA25972 CJA25972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]