SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA26008 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA26008
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.17e-32
Family ABC transporter ATPase domain-like 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA26008   Protein: JA33074   Gene: WBGene00181580
Sequence length 123
Comment JA33074 WBGene00181580 status:Predicted
Sequence
MSGGQCQRAGIARALAVEPKMIIADECIAALDVTIQAQIVDLFRELKSKMQLTLLFIAHD
LAVVRNLCERVVVMYHGEIVEEGLSAEVFARPKEAYTAALISAIPDIDPTKSLFEERILA
EAS
Download sequence
Identical sequences CJA26008 281687.CJA26008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]