SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA26143 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA26143
Domain Number 1 Region: 1-54,104-227
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.89e-22
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA26143   Protein: JA21308   Gene: WBGene00181715
Sequence length 229
Comment JA21308 WBGene00181715 status:Predicted
Sequence
MTDTIVLGAGMVGVSTALALQERGHHVVLVDRKPPGQETSYGNAGIIQTEAVEPYAFPRS
LREILSVALKRGNDVDWRMRDMPYLVGPLWRYFAHSAPQPYARAVATYSKLIMRASADHA
RFIEPAGADELIVRKGWRAVYRTAEKFELAAAAAERLEQIYDVPNTVLGTNEIASLEPTL
RRPLAGAVHWTSPWTCRDPGELVKRYASLFVARGGTLVIGDALSLQQHG
Download sequence
Identical sequences 281687.CJA26143 CJA26143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]