SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA26466 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA26466
Domain Number 1 Region: 18-213
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.88e-43
Family FAD-linked reductases, N-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA26466   Protein: JA37210   Gene: WBGene00182038
Sequence length 214
Comment JA37210 WBGene00182038 status:Predicted
Sequence
MGPITDKVATAERLPQETKVAIIGGGVIGVSTALFLAERGIPVALFEKGEIAGEQSSRNW
GWCRRTGRDSREMPLIVESMRLWEGMNERTGRETGFRITGIAYTAEKEEEVERYAQWIKI
AGEHGIETELLSSKQAASLTPGLTRQLKGGMITPLDGRAEPQKAVPAFAAKAQELGAVIL
QNCAVRGIETTNGRVSAVLTEKGRVACEAIVVAX
Download sequence
Identical sequences CJA26466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]