SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA26548 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA26548
Domain Number 1 Region: 49-286
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.07e-19
Family FAD-linked reductases, N-terminal domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA26548   Protein: JA22048   Gene: WBGene00182120
Sequence length 320
Comment JA22048 WBGene00182120 status:Predicted
Sequence
MASVAPPPATDAICFCGTCLPSSDALLPLKAACKGGMGFAMSKDTDLSPVHVVGGGLAGS
EAAWQIAQAGVPVVLHEMRPVRGTDAHKTEQLAELVCSNSFRSDDAETNAVGVLHAEMRL
AGSLIMACADANQVPAGGALAVDREGFSQAVTAKLEAHPLITIEREEIAGLPPEEWGTTI
VATGPLTAPSLAEAIQAQTGADALAFFDAIAPIVHFDSIDMDVCWFQSRYDKVGPGGTGK
DYINCPMDKEQYEAFVAALIEGDTTEFKEWEGTPYFDGCLPIEVMAERGPETLRHGPMKP
MGLTNEHNPTVKAYAVVQLX
Download sequence
Identical sequences CJA26548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]