SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA26800 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA26800
Domain Number 1 Region: 34-245
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.16e-29
Family FAD-linked reductases, N-terminal domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA26800   Protein: JA22032   Gene: WBGene00182372
Sequence length 262
Comment JA22032 WBGene00182372 status:Predicted
Sequence
MPAIRILPADDNTNGWSKILPARTPRAALKGDIKADWIVLGAGYAGVAAARRLAENRPND
QIALIDAQEVGKGTSGRAAGFAIDLPHNVSSSMEELAKSHSYRALARAAIDHLKQQIDQH
GIDCDWRQDGKFHAAVSDQGMREVLEPTVKELERLKEPFDWLEGDALAKRLGTSHFKAAI
FTYGTSLLNPAALVRGLADSLPDNVTLYENSAVTKIEYGDRILITTPKGSIQAPAMILTV
NGFADNSPMTSTKPSAKSSPGA
Download sequence
Identical sequences 281687.CJA26800 CJA26800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]