SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA26878 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA26878
Domain Number 1 Region: 395-492
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.000000000183
Family N-utilization substance G protein NusG, N-terminal domain 0.016
Further Details:      
 
Weak hits

Sequence:  CJA26878
Domain Number - Region: 16-94
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0178
Family MarR-like transcriptional regulators 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA26878   Protein: JA34659   Gene: WBGene00182450
Sequence length 563
Comment JA34659 WBGene00182450 status:Predicted
Sequence
MKEEATIRRGARNARYAAIPNHVFEEVRLSMEARWLLGYLLSKPDNWTVVLRDIINKGNC
GRDKARRMIAELVELGYAQKEQARDSGRFSALSLVIYDEPFAPVVSESVASLPQTENPST
VNPSTEKPVPVNPPLVITDNLEKPDYRSERGASAIDQEDRKKIELAYWKLVRSWPKLNGT
PQAKWFDTWLALTPEERIQAAEKRDAWVELLRSNGRDHIHVPGTYFENKLWEQVPDAPAP
SSDQPARLEAKPFGKLFGVEVYRNFLTVSPGMISAPTAFERGQIQRGERSEQEIYREKLV
KQGWGSVEGMFERAATGRSTAVSARFSPLCEQMESVRVGGEQWLAWQAYHAERGWRWYPA
PDWLEWVCFPVGGPDGMKDFETALRGIAIRAGGDSPWLVLRVMTGRELCVKNELESVDIE
VLSPMKMGPKLRRQGREIPPKLQPVMIGYVLVRVVMSNENFATLLGFEHVVSILGGYEKP
YTVNAIKVNEFSGKADKGDFDHEVPHTAFVGVKRVKIREGVFAGIEGELLSGGGKGKGVA
VVEIKIFGQPTPMIMPLAFLVPV
Download sequence
Identical sequences 281687.CJA26878 CJA26878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]