SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA27059 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27059
Domain Number 1 Region: 14-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.13e-68
Family ABC transporter ATPase domain-like 0.00000998
Further Details:      
 
Domain Number 2 Region: 259-447
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.5e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0027
Further Details:      
 
Domain Number 3 Region: 404-562
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.86e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27059   Protein: JA37587   Gene: WBGene00182631
Sequence length 790
Comment JA37587 WBGene00182631 status:Predicted
Sequence
RFPKLRRRDMNAYLKLDHIDKYFDRSEVLKDINLSISKGEFVSIIGHSGCGKSTLLNLIA
GLTPVSSGAVLLENKEVNAPGPERAVVFQNHSLLPWLSVYENVNLAVTKVFRSSKTRAER
HDWVMTNLDLVQMAHAKDKRPSEISGGMKQRVGIARALAMEPKILLLDEPFGALDALTRA
HLQDAIMEIHTRLGNTMVMITHDVDEAVLLSDRIVMMTNGPAAKIGEVLDVAIPRPRNRI
ELASDRTYLKCRELRSNPMAEKLVIIGNGMAPGRMLEHLLEQAPDQYDVTIFNAEPRVNY
DRIMLSPVLSGEKTYEQIVIHGDGWYIKHGITLYKGHKVVAIDRDAKTVTSDHGVTESYD
KLVIATGSVPFIIPVPGKDLPGVISYRDLDDVDAMLVAAQSREKAIVIGGGLLGLEAAAG
LAQRGMDVTVLHVMPTLMERQLDPAAGYLLQRAVEQRGIKVICKANTKAVIGKSKVEGVE
LDDGTVIPATLVVMAVGIRPNVGLAREAGLDVNRGVVVDAGMRTSDANILSLGECAEVGG
MVYGLVAPLYEMARVAASHLAGDNTSSFTHSDTPTKLKVTGIDLFSLGDFADGPDREEIV
LRDAMAGIYKRLVIKENRIIGTVLYGETTDGAWFNDLKKKATDISEMRDTLIFGQAYQGG
TPLDPMVAVAALPDDTEICGCNGICKGKIVSTMDEKGLTSLDEVRAHTKASASCGSCTGL
VEQLMALTLGDSYNPRSVQPMCGCTDLGHDDVRRLIKAKSSRPFPPSCRSWNGKHHAAAP
NAVRRLTITX
Download sequence
Identical sequences CJA27059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]