SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA27103 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27103
Domain Number 1 Region: 240-401
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.43e-36
Family Retroviral integrase, catalytic domain 0.023
Further Details:      
 
Weak hits

Sequence:  CJA27103
Domain Number - Region: 2-55
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000114
Family Reverse transcriptase 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27103   Protein: JA20931   Gene: WBGene00182675
Sequence length 894
Comment JA20931 WBGene00182675 status:Predicted
Sequence
MMFALRRFKTIVYGTPVVVCTDHKPLISLLKGSPLADRLLRWSLEILEFNVKIVFVAGKA
NVVADALSRGGAPGVDPTDGETTELTSIINEVRTECEKEDFLNTKNWFKYHQQENEGWRK
VIDELEKGEKQGAVKIEGMKELVKLSDFVLIGKSLRNTENPSCNRMVVPLCVRERLIKEY
HEGALAGHFGTEKLVRQLSRKFMWPKMRATIEKFVKACPKCICTNDHPKLVAPLTPYKTS
YPLEIVACDLIDVGLSIQGNRYVLTIVDLFTKYGTAVPIPDKKAETVLKAFVDRWAIGEG
RIPHTLLTDQGKEFANGMFEQFTKMLKVKHIMTKGYNSRANGAVERFNKTLMHIVKKKIA
LPVEWDDQLPYAIYAYNSIAHKTTGDTPYFLMTGRDPQGPLIMEGEDADGINYSDMEEYK
CVLTQELLKAHRSAKEHARREWEEHKRLFDLKHKVHNRRYPEPGSRVLVEIPSEKLGAKC
PKLINKWKGPYRVISVSENSATVRPVMGNRKETLIIPFDNLRVIPVKMKQDVIIETTKGR
AGVKEKIKPYGDVGSDIVLNLEIKHDNYFSEILFCRCPTPCQFFPADAQKAKTTSPVQLH
RMHQWLEHNPALAANPKDLQVLSKQHFPGSSSPPSLDTIRSLAWCPTIIQTLSGVPMWVK
AWNSVYSDLARIHLKRSSFENKLWIVTTPGVDHKPIPLSASRLSSLSESADLAKMVTNVE
KEKPTAILLVVPFRVNPDELGKKLISELPGDVRVAVVCAPTAIEDYSVAAELEAMLQCMA
SPERPVHLIPPQYRVQSSRNRKLWEIGDSDTIINYWQAVLLVAKEQEVPIELKLRMEEGD
SVSKPVVNVCSTGLSTRPRRRHQGRQSGTGHPTTTTDSLILPPNRGDQRNIGAS
Download sequence
Identical sequences CJA27103 281687.CJA27103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]