SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA27297 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27297
Domain Number 1 Region: 6-95
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.0000000000075
Family ParB-like nuclease domain 0.035
Further Details:      
 
Weak hits

Sequence:  CJA27297
Domain Number - Region: 87-112
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.016
Family KorB DNA-binding domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27297   Protein: JA20012   Gene: WBGene00182869
Sequence length 218
Comment JA20012 WBGene00182869 status:Predicted
Sequence
DIHIDDKRMRGANMEKVAEIAKSISEVGLMNPPAVRVVESMVIEGEEWGRVPILIYGRHR
LLAMQSLGHEVIECEVYEVDELRAELMEIDENLARSELSPAEEAMHIARRKVIWETMNSG
KTIPTIQDGPGRPKEFAAEVASVTGNSKRDVNLKVARARELGPDIQRIVGTSLDKGVEMD
ALAKLPEKERENLISRAEAGEKVSARPAPENKPITADK
Download sequence
Identical sequences 281687.CJA27297 CJA27297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]