SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA27662 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27662
Domain Number 1 Region: 10-229
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.95e-52
Family ABC transporter ATPase domain-like 0.00058
Further Details:      
 
Domain Number 2 Region: 276-461
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 2.62e-28
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27662   Protein: JA36003   Gene: WBGene00183235
Sequence length 477
Comment JA36003 WBGene00183235 status:Predicted
Sequence
MARKTALPVHSKREPLIDLKGAGVYRDGRWLVRNVDLTIHRGEIVTLIGPNGAGKSTTAK
MALHILKPDEGEVHHIKGLRIGYVPQKINIDRTMPLSVERLMTLTGPLPKADIVRALDAV
GITHLLKAEITNLSGGEFQRALMARALARKPDIMVLDEPVQGVDFSGEAALYELIAKLRD
DTGCGVLLISHDLHLVMAATDRVICLNGHVCCSGTPRDVTASPEYLRLFGSRAVGPLAVY
EHHHDHTHLPDGRVLHADGTVTDHCHAEDGHHHDAILLLLQKRHSLSADSLLGILSHATL
SLGLVIVAFMTWVRVDLLSFLFGDLLAVSRLDIAFIYGGGILVLAVLAWLWRPLLAATVS
EDIARAEGLNPALSRIIFMLLLAIVIAISMKIVGILLITSLLIIPAATARRFASTPEQMA
IMASIIGAVGVIGGLYGSVEFDTPSGPSIVVAALAIFILSLLPLNRREASPKRTAGR
Download sequence
Identical sequences CJA27662 281687.CJA27662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]