SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA27706 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27706
Domain Number 1 Region: 28-219
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.45e-53
Family GMC oxidoreductases 0.0037
Further Details:      
 
Domain Number 2 Region: 1-26,218-277
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.11e-24
Family FAD-linked reductases, N-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27706   Protein: JA28238   Gene: WBGene00183279
Sequence length 278
Comment JA28238 WBGene00183279 status:Predicted
Sequence
MLSGIGAADELAEHNIKVVRDLPGVGKNLQDHVDCVMAYECREPVTLYSDLRADKLTLSV
IQGMLFGEGITTTFPYEAGAFVKSRADLAAPDIQLHFMPALEKTANLHFPNPFKKERVEA
NHGFSLRVGPVNPESRGEIRLRSSDPMDRPRIKANYLQTEFDIRTMINAIRMTRDVIKQK
AFDKYRGKELAPGPAVETDAELTKWLRANAMTTFHPVGTCKMGNDPMAVVDAQLKVHGIQ
GLRVADASIMPIISSGNTNAPAIMIGERAAEFILKEAS
Download sequence
Identical sequences 281687.CJA27706 CJA27706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]