SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA27714 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27714
Domain Number 1 Region: 7-126
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.0000000628
Family L,D-transpeptidase catalytic domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27714   Protein: JA24510   Gene: WBGene00183287
Sequence length 363
Comment JA24510 WBGene00183287 status:Predicted
Sequence
MKTKGMTRTSPVMVRIFKEEGVLEVWKQKNNGKYDQIASYEICKWSGKLGPKFIEGDRQA
PEGFYNVRPAQMNPNSQYHLAFNMGFPNAYDRAHNRTGQNLMVHGACSSSGCYSMTDESV
SEIYAFGRDAFKGGQRDFQIQAFPFRMTAANMARYKSDPNYSFWKMLKQGYDSFEVTKVP
PKVDVCEKRYVFNVPTPDGQPLSANDACPPSANAESMAYTTSYEKTFQSAFSAAQKKPAP
SIQGITEAKLVSAWSAARARGEKVTREPPSLSPTSAETPNAPDIAPAATPISAQPTAIAA
TPALAAPAASAPAATPPAQTAAVPVPQENPTAVSPMTTASTVADNVAAPAPEKKKPWWKL
GGN
Download sequence
Identical sequences 281687.CJA27714 CJA27714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]