SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA27780 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27780
Domain Number 1 Region: 39-354
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 9.94e-67
Family DmpA-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27780   Protein: JA28038   Gene: WBGene00183353
Sequence length 361
Comment JA28038 WBGene00183353 status:Predicted
Sequence
MDRRTFAKSLAGLGTIPFLVGSATAAQRGEESMLELMGGSITDVPGMKLGHHTLTKRPTG
CTVLLCEEGATAGVDVRGSAPGTRETDLLDPMNYVQQVQAILLSGGSAYGLSAATGVMRY
LEENNLGFKIGKGVVPIVPAAILMDLGVGDFSVRPDEEAGYLACKAAKAEASGEGNIGAG
AGATVGKMFGMEYAMKGGLGTASYKVPGTDVVVGAIVAVNAVGDVYAPNSQQILAGARNE
DGKGFRNIMDSLMQGRNVVKSGGANTTIGAIATNVPFNKAELKKIAGMAHDGFARSINPI
HTMWDGDTIFALSTGKAEGVEADVTAIGAIAATVMAHAVARAVMQAESLPDLNLPAHRDY
V
Download sequence
Identical sequences CJA27780 WP_024897762.1.22424 281687.CJA27780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]