SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA28183 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA28183
Domain Number 1 Region: 220-526
Classification Level Classification E-value
Superfamily Folate-binding domain 1.3e-67
Family Aminomethyltransferase folate-binding domain 0.0000125
Further Details:      
 
Domain Number 2 Region: 8-129
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000000349
Family L-aminoacid/polyamine oxidase 0.0074
Further Details:      
 
Domain Number 3 Region: 561-636
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000000000015
Family Aminomethyltransferase beta-barrel domain 0.0015
Further Details:      
 
Weak hits

Sequence:  CJA28183
Domain Number - Region: 130-202
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000777
Family FAD-linked reductases, N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA28183   Protein: JA38949   Gene: WBGene00183757
Sequence length 637
Comment JA38949 WBGene00183757 status:Predicted
Sequence
MVGEDLPVMPIDHPLTFFGPYNEFAGTGKEIGWPLLRDQGNSAYMRDTGDPKTAEGGQIE
WGYYEETNPRLCHPRDLLEKHEARLSPSQRDLDMEQVLEPLERAIELTPILGELGYNESH
SFNGFLQVTTDGGPSMGESQKVRGLWYAVAIWVKDGPGMGKLIADWMTDGRTSIDHHAID
YSRFYPHQMTEQFIWDRCTETAMKVYNPAVHPREPFSKGRNIRRSPFYEREKELGGHFME
LGGWERAHGYAANEHLLEKYGDRVPVRENEWDNRHFWRVSNAEHLALSDDCGIINLSHFA
MYDIEGPDHVELMEWLCAAKIGGDANIGKGIYTHFLDDEGMVRADFTAIRMADHIRMING
ADAGPRDFHYMRRVAEDKGFDVTITDVTEKYVTIGIWGPNARDNLKKVVEDPDGLNVENF
AFAAIKPIRIAGKDVTAFRISYVGEQGWELHMRYEDGLAIWDALRSTGAIAVGVETYANT
RRMEKSLRLQNADLLTEYNLLEADLARPKVKEADFCGKAKHLEYKAREHQPAMLCTLVMS
ENVDSKGVARYPVGILPVMDPETGETLVDDLGRRSFTSSIAYGPTIGKNIALAYLPWSYC
QEGRKLNVEYFGETYPVEVVSIGYKPLYDPENLKPRS
Download sequence
Identical sequences 281687.CJA28183 CJA28183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]