SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA28296 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA28296
Domain Number 1 Region: 349-445
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 2.88e-18
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0086
Further Details:      
 
Domain Number 2 Region: 280-346
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 2.65e-17
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.001
Further Details:      
 
Domain Number 3 Region: 194-279
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000000209
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA28296   Protein: JA21952   Gene: WBGene00183870
Sequence length 487
Comment JA21952 WBGene00183870 status:Predicted
Sequence
MALINGLDSFFGKVNQILSSPLSLTMAKSLLSTVVIGVLILIIALLKPIERNGEEGVRPW
PKAFRIFLIIIGLLPIFAAGFGFIGLARFAAQQIVVTGAFLVTMYLGFLTGRAISEEQAF
ASSPIGRVMRDRFHFDEATLDQIGLAVGILINFVVALVGIPLVLMQFGFQWSELKSTFYN
LMTGFQIGNISISLMGILTGIALFVLVYLMTRWFQNWLDNSVMARGRVDSGVRNSIRTVI
GYVGLVLAALVAVSAAGFNLSSLALIAGGLSLGIGFGLQNIVQNFVSGLILLAERPFKVG
DWVEAGTVSGIVKKISVRATEVETFQKQSIVVPNSTLINGNVGNWTLRNKLGRIDINVQA
AYTDEPRRVHSLLLEIIRSHPSILKNPEPFVAFQSMTDSLMIFDVYAHVADITSTGGIKN
ELRFQIVERFHAEGIQLASSSTDLVLGVSEIEKLSELVNKDVSRAAKTRKEKPAEPEKAE
KPEHDDK
Download sequence
Identical sequences 281687.CJA28296 CJA28296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]