SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA28325 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA28325
Domain Number 1 Region: 3-54,115-225
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.2e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA28325   Protein: JA33691   Gene: WBGene00183899
Sequence length 231
Comment JA33691 WBGene00183899 status:Predicted
Sequence
MSNVLIAGAGIIGLSAARSLLAEGHSVTIVDRDPAGDKASFGNAGGLGVTEIVPASVPGL
VWKVPGWLCDPLGPLSVRPAHFPKLVPWLARFMRSGSQSEMLRITNALATLTAPVYDDYM
PLLEELKLTHELHQIGALWVYETEAAFQADAVDRDLRRSYGIIFDEMDGDEARKLEPALG
KAVVRAAMTPQWSHFDDPKRVVDRLRDLVVERGAKLVTGEVLAVDGKLLRL
Download sequence
Identical sequences CJA28325 281687.CJA28325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]