SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA28585 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA28585
Domain Number 1 Region: 118-433
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.18e-32
Family FAD-linked reductases, N-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 4-126
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.13e-18
Family FMN-linked oxidoreductases 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA28585   Protein: JA34853   Gene: WBGene00184159
Sequence length 433
Comment JA34853 WBGene00184159 status:Predicted
Sequence
SGLVDFLNVIRGHIETDAGLTDVIPIQGMPSAPHLDFAGEVRASTGMATFHAAKIQDVAT
ARHAIASGKLDMVGMTRAHMTDPHIVRKIIEKREEEIRPCVGANYCLDRIYQGGSAYCIH
NPSTGRELTMPHVVQKVDQSRHIVVVGAGPAGLEVARVSAERGHRVTVFEAANHPGGQVR
LTAQSPRRREMMGIIDWRMAQCEKLGVEFHFNTWAETDVVLGAAPDVAIIATGGIPDVQI
LREGNELAVSTWDIISGDVRPGANVLVFDEAGDHAGLQAAEFVAASGGKVEIMTADRTFA
PEVMGMNLVPYMRSLQKKDVTFTVGYRLHVIRRDNNRLMAQIGSDYGGVGIEREFDQIIV
NDGTRPMDDLYFELKPLSRNMGAVDYDALIDGRPQKLVGNEESVFELYRIGDAVSARNTH
AAIYDGLRLGKAL
Download sequence
Identical sequences 281687.CJA28585 CJA28585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]