SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA29113 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA29113
Domain Number - Region: 11-138
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00993
Family FAD-linked reductases, N-terminal domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA29113   Protein: JA39173   Gene: WBGene00184687
Sequence length 142
Comment JA39173 WBGene00184687 status:Predicted
Sequence
MTIPSSVDRSIVDGDGHVVLLFTQYTPFSPVDGEWTEEKKIEYAKHVFSEIDAYAPNFSS
SVIGYDILTPPDIQNTFGITGGNIFHGSMSLDQLYLSRPISKWSNYSTPIDSLYLCGSGA
HPGGGVTGAPGRLSALHALKRF
Download sequence
Identical sequences CJA29113 281687.CJA29113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]