SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA29242 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA29242
Domain Number 1 Region: 14-149,310-370
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.13e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.063
Further Details:      
 
Domain Number 2 Region: 207-285
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000126
Family GMC oxidoreductases 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA29242   Protein: JA22133   Gene: WBGene00184816
Sequence length 381
Comment JA22133 WBGene00184816 status:Predicted
Sequence
MGYHPFPSPGGIASTSYVNEYGMQMGPCNHCGFCERFGCYQYSKSSPQTTILDALKRMPN
FSYRTESEVLRIEMAPDGKTATGVTYFDDKTQEEVFQPADIVIMASFQLNNVHLALLSGI
GKPYDPVTGEGVTGRNYAYQLTGGVTLFFKNEEFNPFIGTGANGMCIDDFGVNQIDFGRE
GFIGGAYWRSGQTNGQPIRSMTLPSGTPGWGAGWKSAIAEWYGHSMNIGTHGSVMAYKTN
HLDLDPTYKDPHGRPLMRMTFNWNPNDIRMTQFMKGKAEELAKTMNPDLIQSSFKKEGSQ
FDVRPYQTTHTTGGHTMSANPREGVVNRFSQAWDKHNVFMLGAGNFVQNTQYNPTGLLGG
LAYWTAHAIRTQYLSNPRPLV
Download sequence
Identical sequences CJA29242 281687.CJA29242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]