SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA05236 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA05236
Domain Number 1 Region: 32-61
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000254
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Weak hits

Sequence:  CJA05236
Domain Number - Region: 99-144
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0604
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA05236   Protein: JA27393   Gene: WBGene00124440
Sequence length 182
Comment JA27393 WBGene00124440 status:Predicted
Sequence
MKFEILIAEAARANTILPQGLAVTPAPALTHQPKKAKRECFYCGIPGHFANDCRRRVKDR
ANDIFRRENKADFNPMSQTRSFPQNNPITNHQIFANQPTVQTIQSAVPALHAQMDDLKAE
LEVRQNQINAFIRRNDELAGSAPVAQSSNARVSCFRWSQTCLLTFLTLGSLLTPAFAVDP
LV
Download sequence
Identical sequences A0A2H2I254
CJA05236 281687.CJA05236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]