SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA06339 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA06339
Domain Number 1 Region: 289-334,470-553
Classification Level Classification E-value
Superfamily TPR-like 0.0000303
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA06339   Protein: JA22633   Gene: WBGene00125543
Sequence length 578
Comment JA22633 WBGene00125543 status:Partially_confirmed
Sequence
MYRDGVSKHRHVKSQTGQCGRAAGARCPHGSDSLDLLDTITEVQITLNLFMNNKFELAEE
RMAELYDKSMYHSMGYTSILFIKAVMTVNKQDMEKASEACKMSCEVIDRFRERRSIRETI
FGASAKGKKMSDEELHAELCYAQILLLRAILTFFNDDNFASFIKGALNIRTCYQTYRYCE
KLMNEPSVWVGRNQKVQEQFISGTKMGLGTFSLMLSILPSKVLRLLEVVGFSGDKVAGMR
DLHHVASLTGTLCSPLAKMILLTWNLIACFVLGTGHPDMDDCKRIMPSVISLWPRGAILL
FMRARFLLVSGDIETAIRYFNLSIESQDVYKQFHHGCYWELLFAHSYQRRWAHAANYARL
LMKESKWSRCVYTYLLCIFFAADETVEESKRNETIGVLAAKVDGLRMRIAGKSIPVEKYC
GRKAKRFATTNSLLFAHYEFIYFWNGFDIFGKNSRMVRGVLDDLDRVWEMRKSEADIDDY
CLYYFLKGVSLRHLGLHAQAEECLKIVLDRESTIKSFTYLPPNATFELAMMRITEQQFME
AQTLLDKARTYKSYSLENKLHFRIHSAMGSMGCRTPMI
Download sequence
Identical sequences CJA06339 281687.CJA06339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]