SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA08505 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA08505
Domain Number 1 Region: 619-740
Classification Level Classification E-value
Superfamily TPR-like 0.0000195
Family Tetratricopeptide repeat (TPR) 0.061
Further Details:      
 
Weak hits

Sequence:  CJA08505
Domain Number - Region: 280-376,513-555
Classification Level Classification E-value
Superfamily TPR-like 0.000607
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA08505   Protein: JA39153   Gene: WBGene00127709
Sequence length 790
Comment JA39153 WBGene00127709 locus:Cjp-gfi-3 status:Partially_confirmed
Sequence
MALRPVVKRSYLNLDAIFGHVFSNLTGEPITPTKVATFYLLQVLFETHFGKKDAKSKRPF
TCQEKNKVFQHLYGLMTLEHEIPYKSYRDVVRMAFGTDRDIAYNFYACMEKLGQGVADIN
LNVPDEFYTNRHARDLNQPATDPYFDEYNQSKTLAFSSSQSFMYRWLKRILAEYSKMNQT
QKFDLNTATQQWILSYRGEMQVVSFLFYNLELATALAKSAPLDEIFLPGPPSSHLPTFID
CSLRARSWVAENLYLLQKNPRHAFTYENMLDLARVVEDRHKDVFEAHLLEAAVHVQLQNP
PAAVRAMKAFFDRSMFELNENMVHASRTHRLAVPSQMPLLYAPILTARIYRLFGDLPTAR
HLLRESMQQAQLKGDEICHQMGHLEMHIVEIIGSNPFLQQSIGPLGLPCCSQTEDDFEVC
AEMDSMTKMMLMLRNISQGVYQLQYDDCTETGLRCPTGHDYEERGRKMEGYGYSIMTSNL
IRNGMYAQAKTAAEEMIVYNFIIDPNPENFETETWAVGTVNLAYSHAGLGEYEKALDLLE
EAGFTYSDDLSWQCNRHVVIATAIINFEREFLRNNYKGCEDAISDLRSHSELEYTLRRAL
IVSALGRDTEGIVMLKRLKVVDVRGKIRIHMQVASFYTVLREYERANLELIEAAKLVNVT
TLKDIRAMIRRRKATIMCIQEKNEEALKLLHSCYAEIMKYGSFTEKAVFYITAARAHRMV
DRDPRIWLKHARCLVRKGQWPSMEKLILSEAAALHAPDGMYPDEDKVSKIREMFGKIAAN
YPGRCEWLLI
Download sequence
Identical sequences CJA08505 281687.CJA08505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]