SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA09035 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA09035
Domain Number 1 Region: 87-180
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-28
Family PDZ domain 0.0063
Further Details:      
 
Domain Number 2 Region: 8-63
Classification Level Classification E-value
Superfamily L27 domain 1.77e-21
Family L27 domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA09035   Protein: JA16301   Gene: WBGene00128241
Sequence length 205
Comment JA16301 WBGene00128241 locus:Cjp-lin-7 status:Partially_confirmed
Sequence
MDTPDGPNLERDVQRILELMEHVQKTGEVSIPKLASLQQVLQSEFFGAVREVYETVYDSI
EVDGPAATKAAATAKATVAAFAAAEGHAHPRIIELPKTDQGLGFNVMGGKEQNSPIYISR
IIPGGVADRHGGLKRGDQLIAVNGVNVESECHEKAVDLLKSAAGSVKLVVRYMPKLLDEM
ERRFERQRLRSSQQSPTLPTPSSRR
Download sequence
Identical sequences A0A2H2I7R1
281687.CJA09035 CJA09035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]