SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA10739 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA10739
Domain Number 1 Region: 584-710,803-857
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000678
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA10739   Protein: JA20794   Gene: WBGene00129943
Sequence length 885
Comment JA20794 WBGene00129943 status:Predicted
Sequence
MSKLKGSRLETEVDRVRADANWKRFTELLPSVKSKNSGLEECYEMFQGEIILETYFDQLG
EIVRPNKEHVEKLSPAEQLLSTALRENGANQTVKIEANILLAKVLYSCFEFKKALACISN
SEMENGKTPFRTLRTLRLVAEGYAIKGLCIESMEEPSRSHSNSATSQTSTSSSSKDQKAL
YVFEKSAELAIFYINELEKSMNSSTAKAVVTGSLVAPASAATNAGIKQQEKIGELLERIM
ERVAIIRAKDTAAKKQSSGTEGIEWYRKIITCLGDKYTGERLKQKLSRQFAELLIRATVP
IEEKSMSEAMQTKAQNMKLYHGSHKTFYTPKSKIEEIILLLLINEVLTTREVVLSQSEEL
TSSRILSLQNAKSSYNLLTLKIHKIHFLGELLERIMERVAIIRAKDTAAKKQSSGTEGIE
WYRKIITCLGDKYTGERLKQKLSRQFAELLIRATVPIEEKSMSEAMQTKAQNMKLYHGSH
KTFYTPKSKIEEIILLLLINEVLTTREVVLSQSEELTSSRILSLQNAKSSYNLLTLFFFA
TVLYRTVRFRTVLFRSKFYIATVLFRASFIPRFRAAEEPNWETKKSQLAKAVTLIEECVS
ADPHDYLSLYYAAYFHAIARDLESAKDRCSRSLALNGDQPAAVMLLALIFTAYGDLKGAL
ELVINALGEFEHNYGLMVLRLHIETRFGRIEESLDTCTHLLDFWKRNQAASLGYQQFMAY
SAGIDEERSQKTLNGADGSVLMGREGSQKTGGFFCRHMQTSNTFSPPHHAMPSNASVMDL
SVAESIHGAGASEIGAPPSTASDSLNNGIGDAWSKFRTQADVWMCLAELYIAEGRHEDLT
KVIEQAISMFPSSPQAFYLKVRSVLEEGLERIVLGAYWRVFGLLL
Download sequence
Identical sequences 281687.CJA10739 CJA10739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]