SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA11339 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA11339
Domain Number 1 Region: 250-362
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000871
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Weak hits

Sequence:  CJA11339
Domain Number - Region: 167-276
Classification Level Classification E-value
Superfamily TPR-like 0.00921
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA11339   Protein: JA35273   Gene: WBGene00130543
Sequence length 371
Comment JA35273 WBGene00130543 locus:Cjp-rmd-2 status:Partially_confirmed
Sequence
METSSSCESVWKYAGITAATSAAVGLFLHFARKDDRNIVEIERLQMMVENLNGKFEDVEV
LMKNISEELKRMRLLKNGSGSGSLRNVTFKLAHQILAFVEEVGRRSLRIQNMEMLKRIAN
XYTDDRSYGDTKPSGNLQSQIHSSAMSSFDDVDALFGTDRVQEGYDALKKRYDSGEKSID
ILWRLAKFCNEIANSVDKSKRKDIITEGKKYATEAWDQDSNNFLAARWAALMSGKITEYL
GTKDKIEEGKKCKEYLDRAISIQPKEDAVLHLRGRWALSVANLSWLERKAAAVFYAEPPT
ATVEEAIADLQAAYDINPEWIENTVYLGKALHQKGDKAAAKTYFEKALSIAPKNDNEKEL
LTEAKSLCSKC
Download sequence
Identical sequences CJA11339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]