SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA12963 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA12963
Domain Number 1 Region: 461-536,576-671
Classification Level Classification E-value
Superfamily TPR-like 9.67e-19
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA12963   Protein: JA27676   Gene: WBGene00132167
Sequence length 783
Comment JA27676 WBGene00132167 status:Predicted
Sequence
MNGNANPAFRRQASTAGANPVLTVALTPVPKVDYSVTKGGARTWIVLLVFVFLCCSLYTI
FSAKDLADSHHDLKSYTTSDNDDTPIYTNTDDDDDDDDDDDDDDSPPPQRAGVDRKQEQP
AQEKSVPHAPPIIDSDDEDDEESNEHTLGGRLFAGLRKKITDRLNEFQKVVKEEPKKVKN
EQVLNPREKRKLKKQQQQQQKEEKIELHVEEDDDDDDDDEEQVPAKNEKARSHKEEKKER
HKKYQPVKEEPDLEDDDDDDNDNDNDDDDDDDDDEDDNDGDDDDDDNDDDNQNEPAAKKV
KDAGEDENETTVKRAESKNDVEEKDEEPKLSHRESQRIRRQHARENRRENRPKLGGKKEC
IHKDCPNEDSLKPRKSLLLRKKPVKSVVERVLDDDFDDDDEDDDEDENEHKIQPRNSKTD
DDDDDDEDDRLEDGFHDRDSSISYKRHAITTKEEIGFRDILDKADHLVEKHEYEQAMELF
DHVIAVHPTSSRAYFGKARAYDIRGEIEASETDRDKAIDIYEKLLENAAVPEALFRQVAQ
RLIEKTRFRGLLHQTLNAHRYFIDRFPDELNLQTDFAITFVMMKRYEDARTVLSNVLAND
PNHVMALAYYGYILKAHDDKVEQGVALMRKSLKLSDNEITDPKFYYQLGHGLTTLGNKHE
ADFVYQKAASMGVFMTAQQRSLYNIEGLTARPWWNMDQTPYSKFLKTVERQWATIRQEGM
EILRDCNECWIDHNQQLVIDGQWKYFPIMSEQQFIAASCEKMPQTCLILQDFSSSSNASK
SEV
Download sequence
Identical sequences CJA12963 281687.CJA12963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]