SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA14003 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA14003
Domain Number 1 Region: 208-499
Classification Level Classification E-value
Superfamily TPR-like 6.45e-79
Family Tetratricopeptide repeat (TPR) 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA14003   Protein: JA24833   Gene: WBGene00133207
Sequence length 504
Comment JA24833 WBGene00133207 locus:Cjp-prx-5 status:Predicted
Sequence
MKSVVEGQCGQQNALVGLANTFGTSNQRVAPSNAAASSFLPSSSLGEQMANEFLRQQAST
MAPTSFSMKSMQQNLPQTSSSNNLAMKWTQEFTPRQNALASQWSNQYNGRAMDSAWRQVA
PTSTMAVGPTSSQNLALTDSGMWSSEYLDTVDTSLQQSSGTAQRWADDFLNQEDNYGMEN
TWKDSETFEQRWEEIKQGMESERAMANEYSYQVSEIFKPGRLNLSDCRMRIRSGDIGNAM
LAYEAAVQKDPQDAGAWCKLGLAHAENEKDQLAMQAFHKCLQIDPGNKDALLALSVSQAN
EGMENEALHQLDKWMSSYIGSNVTQVTNQAPMYSSFLDHETFNRVEARFLDAARQQGATP
DPDLQNALGVLYNLNRNFERAVDSMKLAISRNPADARLWNRLGATLANGDRTAEAISAYR
EALKLYPTYVRARYNLGISCMQLSSYEEAMKHFLSALELQKGGNDVSSIWSTMRSAAIRT
ANAPESLLRAVETRDLATVKATIG
Download sequence
Identical sequences 281687.CJA14003 CJA14003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]