SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA14400 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA14400
Domain Number 1 Region: 155-247
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000368
Family Retroviral protease (retropepsin) 0.013
Further Details:      
 
Domain Number 2 Region: 99-139
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000227
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA14400   Protein: JA31097   Gene: WBGene00133604
Sequence length 354
Comment JA31097 WBGene00133604 status:Predicted
Sequence
MTEDQAQCLLWIMGLQSHEHADLRARALRELEHDSRITLTEFTDRLDQVIALRNDADFMG
GPSSTINAVNINRAKQQHHSSRRPSQAHPKSKNSCQSLNTPCYKCGQMHWARDCKLSSNT
VCRNCSKTGHLTKVCKSKRAVNNTIFISQSSARNRNRIYYDVEIEGKKIRMQLDTGAEVT
LMNSKDWMRLNKPKLSQSKINLYTANNELINVKGQFKCNFTLNGHHGSGLCHVTETESLL
GLDWIAQDTTLYQHIIKASVNKISKVVPEAPPDTYKRTPQKMRKEGTTQEALQKFVMSYR
STPLQHLPQHSPHRQSLPKSSPARRLSSNVIVYKYAYTERGETHFTTSHVLEST
Download sequence
Identical sequences 281687.CJA14400 CJA14400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]