SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA16826 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA16826
Domain Number 1 Region: 541-972
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.18e-133
Family Reverse transcriptase 0.0000691
Further Details:      
 
Domain Number 2 Region: 1093-1243
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.77e-36
Family Retroviral integrase, catalytic domain 0.0091
Further Details:      
 
Domain Number 3 Region: 313-414
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000563
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Domain Number 4 Region: 185-220
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000611
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA16826   Protein: JA20119   Gene: WBGene00136030
Sequence length 1443
Comment JA20119 WBGene00136030 status:Predicted
Sequence
MAVDASASEETKRYSFLTFLTGNARDRAEDFMAANAEATVDQIIADLKSTFENELTGQLR
EKQFSKCRQGRGEPIEAYYNRVRALASQAFRAEDRAAIEKKTRDAFLDGLEDSIRYNVKD
KNPKTSRAAFDEALRQEILRDDRAAALQYPQSAAIFEEIRVLSEKWDSQHTPRRNRQQQQ
LQSKQVTASNQKKPKFQGECFFCGILGHMARDCRKKQNAFSAKPNRRAVQNHQQPASNHV
KTATTDNDVQSQMEMYRQQVAELQRLNAELLAEPGRGRTTSCLSWPTAEASPTIASQDRV
NSARVTSPPITTQIPVRINGFPVFALIDTGSTITVAGRAFATRIGIPSLYQASASHAIGL
GGNEVQMAGAAFANICIGTKSWMHRIHFTTGECTPNGARDYHVIFGNDFLSQLPRFFIDY
QAETLHVGEEVIPIGKQHVAHTPKVLDIRVSEDTVAPAQSEKILACHKQWSTDECDTLFL
VTSQNLIDKSLLTAPVLVNNKNIKILVTNPSDHDVFLKENTQAAEAVEVFEEDNNNFAGQ
RKFHDVFSKNAYDLGSSKTDPVHIYTSTEIPVRGRPYRVPVKYQAELQKHINGLLLSKRI
TESNTPWISPIVLVPKKNGSLRVCLDFRKFNEVTVPDNFPLPRIDSIIEKVGGSKYFSSL
DMANGYLQLRLDEESSYKCGFTTEDKVYAYTHLPFGLKSAASYFQKALRTVLAGLDKDVL
VYIDDVLVFSKTFDSHVKSLRTVFSRFRAYNLKASPAKCEFSKKSITFLGHEINETSYSP
NEANLNTIKQLPAPTDAKGVLRFLGMAGFFRKFISNFSNIAEPLTRLNKKDVPFEWTSRQ
QEAFDTLKQLLASKPILTFPNYDKEFNIFTDASAVAQGAMLAQTTNDSNQFQAVAYASRT
LSDTETRYPAIQIELGAIIFALRHFKPYIYMSKIILHTDHRPLKYILAKQKVHEQVARWL
IELQQYDIEIRHIEGKRHTVADCLSRAKDEVAPLPDEKLEDIVEFPVCMAIRKSKDRVAS
RFTQSGTQKSLDIGLEQDKDKDIGIIKRFLEKPSSPIDDISSHWVQFLKRISLSDKGVLV
VQFAGEPARVAIPVFETVGVDLTGPLRTSSKGNKYYINMICWFSKFVISVPLPDATCETT
SRAILDELVLKFGTPNQIVSDNGPAFTAAAFKQFCELLEVSHHRAIPHHSRGNGATERTF
RTFHSVIAKHVNNTHTDWDSVLQFATFCYNTTVHKTTGETPFFLVFGRDPTLTIDRIIDP
APKAGKADIPLFRESLTTVLQEAWEEAAKRSRQAQEEYQKTANKGAKGSGIRPGDRVMYR
DYSNHKGHSRKLTLPWTGDYRVITVNHPLATIREVKNRGKPDRTVHLDQIKKFWAAEDGD
ARSISSQSDAEEPAEVPDVKIPTPSTPPSRPTTSEAQNPVTVQSDDQRRYPSRQHRRPAK
FQD
Download sequence
Identical sequences CJA16826 281687.CJA16826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]