SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA18949 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA18949
Domain Number 1 Region: 184-373,417-463
Classification Level Classification E-value
Superfamily TPR-like 2.4e-31
Family Tetratricopeptide repeat (TPR) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA18949   Protein: JA20365   Gene: WBGene00138153
Sequence length 468
Comment JA20365 WBGene00138153 locus:Cjp-klc-2 status:Partially_confirmed
Sequence
MGMGDDEAPLPKQKLIHINDNLDKLMCGANETSTMLMVFQLTQAMDAQQQKYQAQRRRLC
QENAWLRDELSSTQTKLQQSEQVTAQLEEECKHLKYMASIKQFDDGPQNDTKSSADVGPQ
PVTNETLQELGFGPEDEEDLNTSQFNQPTPAHSMAASANVGYEIPARLRTLHNLVIQYAS
QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIR
EKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNL
ALLCQNQGKYEEVEKYYKRALEIYETKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYK
QILTRAHEREFGQISVENKPIWQIAEEREENKHKGEGVNNGEQVGWTKAAKVDSSFPTVT
TTLKNLGALYRRQGKYEAAETLEDVALRAKKQSTHANYNNFYFFHPQN
Download sequence
Identical sequences 281687.CJA18949 CJA18949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]