SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA20544 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA20544
Domain Number 1 Region: 104-139
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000251
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Weak hits

Sequence:  CJA20544
Domain Number - Region: 188-227
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0034
Family Recombinase DNA-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA20544   Protein: JA36142   Gene: WBGene00176116
Sequence length 362
Comment JA36142 WBGene00176116 status:Predicted
Sequence
MGELSDDYQLRSLMEWQLREIPEEIQYDECRKFATVLEKGKLEMQKSRTKEKTDNQQVKQ
PSMPAQRLPSFRQNLSEVSKKEEAQFPNPIGRSEKRVAFPSSGECDQLGYHLPTCSKAPT
VSCYYCGGKGHYSIKCPKKLETPLEQRQGQTLAVEKLERSTAEAARGSGDIQIEIGKIGN
TVMEFLIDSQVDLMVQLNMSISLMSARIHCSRTLNDCYMSDPVAYGTSKSTGRARKLKQR
DERNVARAVSNTMKSAKDIWKHHAPNHAANPYNSTRAFLASKKIKVLDWPACSPNLNPIE
RVWGFLTRSVYKNGKQFNSISELKDAVRTEWSKIHPSYLENLSNSMPSRIFQVIQKNGGF
TG
Download sequence
Identical sequences 281687.CJA20544 CJA20544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]