SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA20898 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA20898
Domain Number 1 Region: 264-434
Classification Level Classification E-value
Superfamily TPR-like 1.71e-35
Family Tetratricopeptide repeat (TPR) 0.00038
Further Details:      
 
Weak hits

Sequence:  CJA20898
Domain Number - Region: 60-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000841
Family C2HC finger 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA20898   Protein: JA25590   Gene: WBGene00176470
Sequence length 434
Comment JA25590 WBGene00176470 locus:Cjp-snap-1 status:Partially_confirmed
Sequence
MADNEAKARQKMAEGRKKLHGGGGFFSKVFGGGGGSSEAADLFIQNEEEEPIASNGEIEI
ECSHPGCEFIAANLLQYEQHYAQHSFQCSQCGAAFDTAHRLEIHHDERHNPFFELQVARQ
PAVAHFRCLHPTCGILFSNDRTRDEHSRVVHFIDCDKSRRRKLEDVGISAVLSNSLGKMS
IGGDAEQEGGWTGENTEETCSRWPNSGKKPEKRSLRPPSSMANRVIRNTTAPLNTLRLPT
ASARFSRRYVFFCSTYKYISTKLLQCLEKTSEIYTDMGRFTMAAKNHVSIAELYETELPD
KDQCVKHYQQAADYYKGEEQKSSASKCLVKVAMYSAELEKYQQAIAVFEEIAYYEADHST
LKYAAKGHFFQALLCHLCIDPINTQQAIQKYENVSPSFSDSRECKFVKELLASVEDKNEE
TYTETIANFDKISR
Download sequence
Identical sequences CJA20898 281687.CJA20898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]