SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA25181 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA25181
Domain Number 1 Region: 752-1188
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.89e-27
Family Reverse transcriptase 0.013
Further Details:      
 
Domain Number 2 Region: 1473-1591
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000493
Family Retroviral integrase, catalytic domain 0.034
Further Details:      
 
Weak hits

Sequence:  CJA25181
Domain Number - Region: 351-382
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000453
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 
Domain Number - Region: 497-563
Classification Level Classification E-value
Superfamily Acid proteases 0.0024
Family Retroviral protease (retropepsin) 0.025
Further Details:      
 
Domain Number - Region: 387-419
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0419
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA25181   Protein: JA35392   Gene: WBGene00180753
Sequence length 1876
Comment JA35392 WBGene00180753 status:Predicted
Sequence
MSLSGKKGALTRACNNMKEHLAKAEDKVETWEEIPRDGIQPHFDDISMMFDFLQAKQSTL
EKALSNLEIEADKIDKSDTVTISKTDEAINEAIDLLENVGDIVARMSHQLKRATPKEDIK
IQEETLDTSIRTFTQVDPNNQFGYEDYRFDHTKLPTFRGNTWEFESFWTQYEELVDKANR
SKLVKFNKLLSVLEGEPKELLSRYKVTEDNYNKAVDLLKKKYNDTERIISQLTQQMKNET
ATSGQTNDQRKLFEKILIITSQLISYGETIDTRMVKEEIVGKFHTRIQTEVFKKKMDNKV
PWTLEKILDDIETFIHREEEMNLLMKKDHDNHSKSKRDNLKSDKQKFNKHFKSDKDEACI
FCQQKGHFFGSCRNKPNPIERMQILKENSRCRRCTKHGHEIKDCKAGMCPVCGKDHHSSV
CFEKHKDAMPPKPANTSKEKYQKKTPSTTIAAVMTQGQDSQEIETLGQAKQSKEMAFIPT
IMTEAFNKEKQKWTKMSSMLDSGADQTVITRKMQKSWGLPNYGNVTVGTNVFNTKNELQT
FGLSAITIRLQDTERTLDVYVAESLAGHITKAPLSPEDMRYILQNKIDLNEDALIPTVEP
DMLIGMDNLCEILTGHIIKLPSGISIWGTKAGFTTGGTNNPKDKLTSIYPVDKKSSSFKE
NTIMVLQTEPKDPERLQEDEQIKDTVMRLQNEYSGPVKEEQELRDKKTVEFFEETVEKRE
EGYYVRLPFKENHPPLPDNYSIAYRRLAQLQKQHPNEVLQMIKAVFEEYETKNFIERVDK
QEATDNKIHYNALQAVITPSKSTTKCRIVVDASSHYKEKPCLNDIIEQGPSILPDIADMF
IRFRTGKTVLISDVEKAFLQVFLHEDDRDVTRILWFKDIEKPVSEDNIVVYRFTRVLFGL
NTSPFQLAKVLIHHLFQYRDDPIMAEVPNNIYVDNSIVTTDKNPQEVIEVYKKLKKVFKE
ANMNLREFRSNCPLVNENIEEVDRSKEEDMKVLGIWWISNKDIIKMKVNFELALKNSRRT
VSSDIASKYDPMGFLVPLLLPPKLFQRELWDEIQYGWDTDLAEKHETEYRKKIEDINDFS
IEMPRQIFEKTGRNSIITFCDASKEATACCVYVKNELGTHIVFGKAHARPLKEKWTIPKL
EMHALRLGTEKTLKVLKALKEGNTPVDQVIIMSDSTIALSWIKSIPTHKEVGTLISNRLK
DIVSFVNDIEDMGTPTRFGHVKTEENPADLGTRGCSKDEFATSIWWNGPKFIEKDIKSWS
LDHKLFRIEEDNTIHMNPMITADNTSLFDRQSTNSFGKMTRIATHVLKAVKLFSKNLSTK
LGSERFLAVKDITTDTGHLNATELKAGEMTLIKDHQKMISPKQLQKYANLGIVKNEDGLL
VARGRMELADMDKATKEPILVMPNSTIATQIIQWSHGRFHKPVDHTMDTVRRKFWIPKLR
QKVKSYMNHCATCQRFNKQTCQYPNMGRLPGHRVIKSRPFANTGLDNFGPIKIKEADGTD
GKAYGTIFTCSVTRLIHVETVKDASAFEFIQAFRRFVAIRGRPDLIVSDNGTNFVLSQKL
LEEASKRSDYPEDMQMIKWKFITPLSPWKGGISHDYAIRSYSFDQQSTTHQARRGHQFGT
TDTPNDFINAEMKIHLPLERVLEIEEEFIPSSELQTKESMLSTVAALKSSIQATERVWTI
WNNKYLAEIREGHRLRMDKKRGSKKLPKEGQLVLMSDDLQPRNVWKMAKVVKINRSSDDT
VRDVEILTPSGRILNRSINMIVPLELDYNDLESSDQQEENEQDNPGETQEDTPDEYTPQQ
RRYNLRNRKTTNYNENELFRNFAFQLNSSLGTTLQCFCLLMLCLITGIDPDCMSPSPRHT
APCMGRLDSKFRGNGQ
Download sequence
Identical sequences 281687.CJA25181 CJA25181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]