SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA25888 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA25888
Domain Number 1 Region: 187-309
Classification Level Classification E-value
Superfamily TPR-like 3.54e-22
Family Tetratricopeptide repeat (TPR) 0.0035
Further Details:      
 
Weak hits

Sequence:  CJA25888
Domain Number - Region: 57-106,143-168
Classification Level Classification E-value
Superfamily FKBP-like 0.000245
Family FKBP immunophilin/proline isomerase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA25888   Protein: JA25728   Gene: WBGene00181460
Sequence length 341
Comment JA25728 WBGene00181460 status:Predicted
Sequence
MSVRATVVKRTVSGGKGKIPEYADGTKAIFHYQTLFPIEKPEKGQQLPAEKDAYKPIDDT
RKAWPDGYGKPLELVFGKKFQLPVFEQCLKTMLVDEISQFDIECIDLVQYPFVSKKLRDI
AKPCDGKHHAHTTHMCAASVAQGTGYDELDELMKNPRPLRFVFHLLSVFEPHQYEHDSWQ
LDEQGKLDSVEVLRQKGNDHFVKKEFKEAIDFYKDALTRLDTLILREKPGEPEWLELDKK
NIPLYANMSQCYLNIGDLHEAEETSSEVLKRENFNEKALFRRAKARIAAWKLDEAEEDLK
LLLRNHPAAAALVAREMKIVTERRVEKQNDSRNTYSKMFKQ
Download sequence
Identical sequences 281687.CJA25888 CJA25888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]