SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA26177 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA26177
Domain Number 1 Region: 228-350
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000104
Family Tetratricopeptide repeat (TPR) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA26177   Protein: JA35443   Gene: WBGene00181749
Sequence length 457
Comment JA35443 WBGene00181749 locus:Cjp-tag-315 status:Predicted
Sequence
KMSDLPSTSTYVAHDEEDPETMEDDVTFEGVDVASHLRISESQSENESASKNAEDRDLVH
AINMFMRNEYDYDEFMRVTGGQTLQEEMGGATKVRRYHNSHREDDVEEVYTGDDDEGEDD
EDVELMEEVEATPSLSATTPSMANRYDALPEEARVIMTELMAEGLGPNKNLSDVLQAQFD
TIVPPLKQIKLESVQTKTTEGESAAPTSSSNEESSRVGRETHNRGKTKRLDALLGQANVQ
AARGNTADAMELLREVIRQDHKHAMAYHQIATVYEQMGEHQKALQFGLLASHLDHRTPSD
DWLHWGDEAKRFGMFEEAAVCYDRALHLKSDNWLYYEKRIEMLEQLDLRPLAMRTRLQAA
QMIDHQLADVGFRWFHDLIRKVAQYYITMNDEEKAILALEAFVLRSREFGEKADAQHETL
VNMYLSKNNFQSAGKSIVSLCKGIKVVKMGTDDSACV
Download sequence
Identical sequences 281687.CJA26177 CJA26177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]