SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA27148 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27148
Domain Number 1 Region: 2-295,488-549
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.79e-37
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27148   Protein: JA21679   Gene: WBGene00182720
Sequence length 551
Comment JA21679 WBGene00182720 status:Predicted
Sequence
MKNADAIIIGSGLAGLVAAHELTSAGRKVILLEQEGENSVGGQAFWSLGGLFMVDSPEQR
RLGIKDSLDLARQDWLGSAQFDRPEDYWPKQCAEAYLQFAAGEMRSWLHSLGMRWFPVVG
WAERGGAQAHGHGNSVPRFHVTWGTGPGVVAPFERLMREAISNGLLTLKCRHRANEIVMT
NGQASGVRGDILVPSTVERGQSSSRDAAGQFELSANCVIVTSGGIGGDPERVRRAWPRDR
LGNPPENMVLGVPAHVDGRGIDIAVSAGGHVINGDRMWHYTEGLRNWNPIWPNHGIRILP
GPSSMWFDAEGNRLPLPYLPGFDTLGTLKHILATGYDYSWFILTEKIIRKEFSLSGSEQN
PDLTGKDWKLLIKSRLGKTPPPPVKAFIDHGEDFVTATNLDELVVKMNQLTGQKLLNLTH
IRNQIEARDREVTNRYSKDAQITAIHNARAYIGDRLTRAVPLHALLDPNNGPLIAVKLHV
LTRKTLGGLHTDLDSAVLDARGEPVPGLYAAGEAAGFGGGGYHGYNALEGTFLGGCIFSG
RAAGRGAARAL
Download sequence
Identical sequences CJA27148 281687.CJA27148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]