SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA27507 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA27507
Domain Number 1 Region: 295-423
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000555
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 
Weak hits

Sequence:  CJA27507
Domain Number - Region: 60-123
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0366
Family TTHA0227-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA27507   Protein: JA24251   Gene: WBGene00183079
Sequence length 471
Comment JA24251 WBGene00183079 status:Predicted
Sequence
MGSMTATFTTKAFSFQNVMRRSVAAFAALAIAVTGVLPAQAQSRGGGVPIVRDAEIEALV
ADYAAPILKVAGLGGRGVRVILVNSQSFNAFVDGRRIFINTGAIMQAETPNEIIGVIAHE
AGHIAGGHQDRLREQLSRARTMAVIGMLLGVGAGVAGAASGSGAAAGAGGGIAMGSTEMA
MRSLLSYQRTEEMTADRLAVNYLNATGQSTKGMLDTFQRFASALSLSGTQIDQYRISHPL
PRERISNLEELAKKSPNYNKTDSAALQLRHDMARAKIAAYSNNMGALQRMFRGNPGGLPA
RYGSAITTYLNGSARSALPKFDALIKEQPKNPYFQEMMGEVLIKANNPQGAAKAFQRAVS
LDTRKSPLLRMSYGRALMLTGTKANMPTAIKEIKAGIASDPEFPGGYGYLAQAYGQSGDM
ARADLATADMNYYSGKLQQAQIFAIRAQKQMKSGSPDWMRAQDIINAKAKK
Download sequence
Identical sequences 281687.CJA27507 CJA27507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]