SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA28935 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA28935
Domain Number 1 Region: 183-352
Classification Level Classification E-value
Superfamily TPR-like 0.0000116
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA28935   Protein: JA19974   Gene: WBGene00184509
Sequence length 454
Comment JA19974 WBGene00184509 locus:Cjp-che-11 status:Predicted
Sequence
TDQRVLTTFVTSEHGIQLQDIQQKSSHCGKLVSVSVPNFYFVRKSGWDEDDSRGEKTIGK
TLVAKCLREFLGNESCDEATTRAMMDFSFYLTIGSMDAAFKAIQFIQSDSVWEHMASMSI
KTRRLDVAMVCLGHMKNVRGARAVRKAHQNGENDSMKCAALALELGMLEEAQIIYAQNER
YDLVNKLHQKQNAWSQAFEIAETRDRIHLRNTHYNYAKFLEAKRDSSVIEAAITNYEKAG
VHAFEVFRMLKDYPKQIEQYVRRKREDTLYSMWGAYLESVGELEGAISFYHSAKDFYCLV
RVKCIQGKIEEASKLAEDSKDKAACYLIGRMYEGDGDVVKAVKFFTKARALSSAIRLAKE
HDMKDRLANLCLMAGGAELVSAARYYEDMPGYAHKAVMLYHKAGMIGRALDLAFRTEQFS
ALDLITKDLDAGTDPKTLKRAAEFLRAIKITRKR
Download sequence
Identical sequences CJA28935 281687.CJA28935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]