SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA29014 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA29014
Domain Number 1 Region: 182-212
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000111
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  CJA29014
Domain Number - Region: 254-287
Classification Level Classification E-value
Superfamily Acid proteases 0.00497
Family Retroviral protease (retropepsin) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA29014   Protein: JA21634   Gene: WBGene00184588
Sequence length 305
Comment JA21634 WBGene00184588 status:Predicted
Sequence
MLSQLYLEQNLPEPPKYTAEEDSVSMGAFERTFAMKFGRLSTEQQVTLLETKYLAGKALK
AFRGLVETEKDSVRSILRVEDFCLLIDEVARVAYRRLPPEELSSLKTAKLLEAIAGSEAL
RCMIDAKLLESPEKEHYDISRLLAIRHEMILKEFREKREVRSERDGKMVTLNREVRNFSN
VLPNCQSFPNVAVQCFKCGGYGHTARICPTLAETPVQRNALKEPNLKVESIDIKGLDLQQ
RKRVKKDVARGTKMIEKGKIGSADVDFVIDSGSCISLMSMKTWRRILKINGVEWKKEVRK
EKTLI
Download sequence
Identical sequences CJA29014 281687.CJA29014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]