SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA29020 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA29020
Domain Number 1 Region: 16-113,140-262,381-419
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.24e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.084
Further Details:      
 
Weak hits

Sequence:  CJA29020
Domain Number - Region: 266-359
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0011
Family D-aminoacid oxidase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA29020   Protein: JA22047   Gene: WBGene00184594
Sequence length 426
Comment JA22047 WBGene00184594 status:Predicted
Sequence
MTREEILSGLHESPKVDVCVVGGGINGISVFRELTLQGLSVVLVEKHDYCSGASAALSRM
VHGGLRYLENGEFNLVKESLVERDRLLRNAPHLVHPLPTTVPVFGVFSGLANSIVRFLGL
SRKPSRRGAIVVKAGLSIYDYLTRKRALMPKHHFRGRRATLDKWPALNPTVKSSATYYDA
WVKQPERIGFELLQDGFSAGPNARALNYAELQSQGNGGFTVLDHINGTRTPIQPTLIVNA
TGGWIDIANENLLPEASHGAPLLGGTKGSHLIIENDALRNALGEHMLYYENEDGRICILF
PYLGKVLVGSTDIRIDNPEEAICSPDERDYILQSLGFVLPDIKIEPRDIVFQFSGVRPLP
ASKDNFTGRIPREHYCTFIEPTGIGHTGVNPPILCMIGGKWTTFRSFGALAADLVLQRLN
RPRLVX
Download sequence
Identical sequences CJA29020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]