SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN09913 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN09913
Domain Number 1 Region: 83-315
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 6.15e-77
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00000558
Further Details:      
 
Domain Number 2 Region: 11-83,320-518
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.83e-72
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN09913   Protein: CN13417   Gene: WBGene00148638
Sequence length 521
Comment CN13417 WBGene00148638 status:Partially_confirmed
Sequence
MAMANNGSVANKVCLIVIDGWGISEDPYGNAILNAQTPVMDKLCSGNWAQIEAHGLHVGL
PEGLMGNSEVGHLNIGAGRVIYQDIVRINLAVKNNQLVNNENLVDACNRAKNGNGRLHLA
GLVSDGGVHSHIDHMFALINAIKELGVPELYLHFYGDGRDTSPNSGIGFLQQTLDFLEKT
VGYGKLATVVGRYYAMDRDKRWERINVAYEAMIGGVGETSDEAGVVEVVRKRYAADETDE
FLKPIILQGEKGRVQNDDTLVFFDYRADRMREISEVMGMERYKDCNSKLSHPSNVQVYGM
TQYKAEFPFKSLFPPASNKNVLAEWLAEQKVSQFHCAETEKYAHVTFFFNGGLEKQFEGE
ERCLVPSPKVATYDLQPEMSAAGVADKMVEQIEAGTHPFIMCNFAPPDMVGHTGVYEAAV
KACEATDIAIGRIYEATQKHGYSLMVTADHGNAEKMKAPDGGKHTAHTCYRVPLTLSHPG
FKFVDPADRHPALCDVAPTVLAIMGLPQPAEMTGVSIVQKI
Download sequence
Identical sequences G0NZ45
CBN09913 135651.CBN09913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]